PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI11G15600.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 741aa    MW: 78071 Da    PI: 6.5674
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI11G15600.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS370.22.8e-11345374078374
             GRAS  78 laalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAee 171
                      l++++++++++P++kf+h+taNqaI ea++ge+rvH++D+di qG QWpa+lqaLa+Rp+gpp+lR+Tgvg+       +++etg+ La++A++
  ORUFI11G15600.1 453 LKVYQILYQACPYIKFAHFTANQAIFEAFHGEDRVHVVDLDILQGYQWPAFLQALAARPGGPPTLRLTGVGH----PPAAVRETGRHLASLAAS 542
                      6899********************************************************************....99**************** PP

             GRAS 172 lgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyys 265
                      l+vpfef++ +a+rle l++ +L+ + gEalaVn v +lhr++      +s+ + +L+++++  Pk++++veqea hn++ Fl rfleal+yys
  ORUFI11G15600.1 543 LRVPFEFHAAAADRLERLRPAALHRRVGEALAVNAVNRLHRVP------SSHLPPLLSMIRDQAPKIITLVEQEAAHNGPYFLGRFLEALHYYS 630
                      *********9999*****************************9......445566*************************************** PP

             GRAS 266 alfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgsl 358
                      a+fdsl+a++p+es +r+kvE+ ll++ei+nvvacegaer++rhe+le+Wr+ +e  GF++vpls  a+ q + ll  ++ +dgyr+ e+sg+l
  ORUFI11G15600.1 631 AIFDSLDATFPAESTARMKVEQCLLAPEIRNVVACEGAERVARHERLERWRRLMEGRGFEAVPLSAAAVGQSQVLLGLYGaGDGYRLTEDSGCL 724
                      ********************************************************************************************** PP

             GRAS 359 vlgWkdrpLvsvSaWr 374
                      +lgW+dr+++++SaWr
  ORUFI11G15600.1 725 LLGWQDRAIIAASAWR 740
                      ***************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098554.535364719IPR005202Transcription factor GRAS
PfamPF035149.8E-111453740IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 741 aa     Download sequence    Send to blast
MGTTTMLNAA DMAGGGAKLQ QQQAPTSPTA SVSESNIVAS TASADPEAND ALAGLQALRF  60
DGGGDIDDVE IQSPDIALWE SIFADQIGVS GAGADFLLSM SSAAASPRRD FMACSPKRDY  120
MVTTSSPKRD YMVTSSPKRD YMVSSPKREY MVTSPRREMA TSPRRATFSN LYTSSHGGGG  180
GGGHHLHHQS YVHGGGMEGG GGGHGAQPQY GGLAGHGKGK AQSPLHKVYI NNVGGGSGGG  240
GVKSNTPSTL SCASSYVVHG GESGLPSLPS MDPFLEEGYL GSYQLPEKAA GGVGGGGGGD  300
INRSGASVSV VTAPASSQLL PTLSECLAMP EPAAYRGGGD EAVAAAMAVA GELPVGAFVQ  360
PEMYYGGGGE FGGEGMTPPL QHQMAADSSL HSMLGSVIQS EAEQEQDSGL QLVHLLLACA  420
DLVSKGDHPA ALRHLHLLRR VASPLGDSMQ RTLKVYQILY QACPYIKFAH FTANQAIFEA  480
FHGEDRVHVV DLDILQGYQW PAFLQALAAR PGGPPTLRLT GVGHPPAAVR ETGRHLASLA  540
ASLRVPFEFH AAAADRLERL RPAALHRRVG EALAVNAVNR LHRVPSSHLP PLLSMIRDQA  600
PKIITLVEQE AAHNGPYFLG RFLEALHYYS AIFDSLDATF PAESTARMKV EQCLLAPEIR  660
NVVACEGAER VARHERLERW RRLMEGRGFE AVPLSAAAVG QSQVLLGLYG AGDGYRLTED  720
SGCLLLGWQD RAIIAASAWR C
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-4845674080375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1363770.0AC136377.4 Oryza sativa Japonica Group chromosome 11 clone OSJNBa0028G07, complete sequence.
GenBankAC1377590.0AC137759.4 Oryza sativa Japonica Group chromosome 11 clone OSJNBb0008H02, complete sequence.
GenBankAP0149670.0AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015616711.10.0PREDICTED: DELLA protein RHT-1-like
TrEMBLA0A0E0R8T90.0A0A0E0R8T9_ORYRU; Uncharacterized protein
STRINGLOC_Os11g31100.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP92213141
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.11e-91RGA-like 1